PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.22252s0010.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family NAC
Protein Properties Length: 559aa    MW: 62861.4 Da    PI: 4.2248
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.22252s0010.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.11.4e-5291361128
                   NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                           l+pGfrFhPtdeelv +yLk+k+ +k++++ ++i+ +d+yk+ePwdLp k k+k+++ ewyfFs  dkky +g+++nrat+ gyWk+tg
  Bostr.22252s0010.1.p   9 LAPGFRFHPTDEELVRYYLKRKICNKPFKF-DAISVTDVYKSEPWDLPdKsKLKSRDLEWYFFSMLDKKYGNGSKTNRATEMGYWKTTG 96 
                           579**************************9.99**************95347777888******************************* PP

                   NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                           kd+e+ + ++++vg+kktLv++kgrap+ge+t+Wvmheyrl
  Bostr.22252s0010.1.p  97 KDREIRN-GSKVVGMKKTLVYHKGRAPRGERTNWVMHEYRL 136
                           ******9.9******************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.94E-627159IPR003441NAC domain
PROSITE profilePS5100558.4329159IPR003441NAC domain
PfamPF023651.3E-2711136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009819Biological Processdrought recovery
GO:0010150Biological Processleaf senescence
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 559 aa     Download sequence    Send to blast
MGRGSVTSLA PGFRFHPTDE ELVRYYLKRK ICNKPFKFDA ISVTDVYKSE PWDLPDKSKL  60
KSRDLEWYFF SMLDKKYGNG SKTNRATEMG YWKTTGKDRE IRNGSKVVGM KKTLVYHKGR  120
APRGERTNWV MHEYRLVDED LEKTGVQQDA YVLCRIFQKS GSGPKNGEQY GAPFVEEEWE  180
EEEDMTFVPD QVLGSEDHVY VDMDDIDQKS ENLVVYDAIP IPLNFNHGES SNNVETNYSD  240
SINYIQPGNY VDSGGYFEQP AESSEKDQKP IIRDGSLRNG TLFQDEEIAC GVQDEHTANL  300
QSSDIIFGTD SSCYNDFPVD SNYLTGEAFL DPNSNLLQND GLYLETNDLS STQQDGFDFE  360
DYLTFFDEDD ENAQNLTFDP SQLMGNEDVF VDQEELFQEV ETGELEKEET SGGKQVVEEK  420
EKDEASCSKQ VDADATEFEP DYKYPFLKKA SHMLGAIPAP PAFASEFPTK DAAIRLNAAQ  480
SSGSAHVTAG IITISDSNMS WSYGKNGNLD LILFYGLVQE NASGKSGNSL TRALLIFMCF  540
WVLLLSVSFK VSTLVASR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A4e-46816519174NAC domain-containing protein 19
3swm_B4e-46816519174NAC domain-containing protein 19
3swm_C4e-46816519174NAC domain-containing protein 19
3swm_D4e-46816519174NAC domain-containing protein 19
3swp_A4e-46816519174NAC domain-containing protein 19
3swp_B4e-46816519174NAC domain-containing protein 19
3swp_C4e-46816519174NAC domain-containing protein 19
3swp_D4e-46816519174NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00343DAPTransfer from AT3G10500Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0510030.0AY051003.1 Arabidopsis thaliana unknown protein (At3g10500) mRNA, complete cds.
GenBankAY0793450.0AY079345.1 Arabidopsis thaliana unknown protein (At3g10500) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002882677.10.0ANAC053
SwissprotQ949N00.0NAC53_ARATH; NAC domain-containing protein 53
TrEMBLD7L8Z70.0D7L8Z7_ARALL; ANAC053
STRINGfgenesh2_kg.3__1085__AT3G10500.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31922762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10500.10.0NAC domain containing protein 53